Name | ALAD antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-3444 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | ALAD antibody was raised using the N terminal of ALAD corresponding to a region with amino acids QPQSVLHSGYFHPLLRAWQTATTTLNASNLIYPIFVTDVPDDIQPITSLP |
Purity/Format | Affinity purified |
Blocking Peptide | ALAD Blocking Peptide |
Description | Rabbit polyclonal ALAD antibody raised against the N terminal of ALAD |
Gene | ALAD |
Supplier Page | Shop |