| Name | ALAD antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3444 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | ALAD antibody was raised using the N terminal of ALAD corresponding to a region with amino acids QPQSVLHSGYFHPLLRAWQTATTTLNASNLIYPIFVTDVPDDIQPITSLP |
| Purity/Format | Affinity purified |
| Blocking Peptide | ALAD Blocking Peptide |
| Description | Rabbit polyclonal ALAD antibody raised against the N terminal of ALAD |
| Gene | ALAD |
| Supplier Page | Shop |