| Name | RHCE antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7493 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | RHCE antibody was raised using the N terminal of RHCE corresponding to a region with amino acids SSKYPRSVRRCLPLCALTLEAALILLFYFFTHYDASLEDQKGLVASYQVG |
| Purity/Format | Affinity purified |
| Blocking Peptide | RHCE Blocking Peptide |
| Description | Rabbit polyclonal RHCE antibody raised against the N terminal of RHCE |
| Gene | RHD |
| Supplier Page | Shop |