| Name | DAZAP1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4724 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human |
| Antigen | DAZAP1 antibody was raised using the C terminal of DAZAP1 corresponding to a region with amino acids QAAPDMSKPPTAQPDFPYGQYGLGSYSPAPPGCGPHFVYSLMVRLSSDVA |
| Purity/Format | Affinity purified |
| Blocking Peptide | DAZAP1 Blocking Peptide |
| Description | Rabbit polyclonal DAZAP1 antibody raised against the C terminal of DAZAP1 |
| Gene | DAZAP1 |
| Supplier Page | Shop |