Growth Hormone 2 antibody

• Supplier: Fitzgerald
• Catalog: 70R-1713
• Prices: $275.00
• Sizes: 100 µg
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: Growth Hormone 2 antibody was raised using the middle region of GH2 corresponding to a region with amino acids NQSYSKFDTKSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSC
• Purity/Format: Total IgG Protein A purified
• Blocking Peptide: Growth Hormone 2 Blocking Peptide
• Description: Rabbit polyclonal Growth Hormone 2 antibody raised against the middle region of GH2
• Gene: GH2