INSIG1 antibody

Name INSIG1 antibody
Supplier Fitzgerald
Catalog 70R-6594
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen INSIG1 antibody was raised using the middle region of INSIG1 corresponding to a region with amino acids WWVPPCCGTASAVIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINH
Purity/Format Affinity purified
Blocking Peptide INSIG1 Blocking Peptide
Description Rabbit polyclonal INSIG1 antibody raised against the middle region of INSIG1
Gene INSIG2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.