| Name | MYBPH antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6049 |
| Prices | $375.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | MYBPH antibody was raised using the N terminal of MYBPH corresponding to a region with amino acids LELCREGASEWVPVSARPMMVTQQTVRNLALGDKFLLRVSAVSSAGAGPP |
| Purity/Format | Affinity purified |
| Blocking Peptide | MYBPH Blocking Peptide |
| Description | Rabbit polyclonal MYBPH antibody raised against the N terminal of MYBPH |
| Gene | MYBPH |
| Supplier Page | Shop |