| Name | PQLC1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7332 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | PQLC1 antibody was raised using the middle region of PQLC1 corresponding to a region with amino acids TYLSIDSALFVETLGFLAVLTEAMLGVPQLYRNHRHQSTEGMSIKMVLMW |
| Purity/Format | Affinity purified |
| Blocking Peptide | PQLC1 Blocking Peptide |
| Description | Rabbit polyclonal PQLC1 antibody raised against the middle region of PQLC1 |
| Gene | PQLC1 |
| Supplier Page | Shop |