| Name | ATIC antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1295 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | ATIC antibody was raised using the middle region of ATIC corresponding to a region with amino acids RTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVKYT |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | ATIC Blocking Peptide |
| Description | Rabbit polyclonal ATIC antibody raised against the middle region of ATIC |
| Gene | ATIC |
| Supplier Page | Shop |