Name | SRRD antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-3668 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | SRRD antibody was raised using the middle region of SRRD corresponding to a region with amino acids DIFNDTSVHWFPVQKLEQLSIDIWEFREEPDYQDCEDLEIIRNKREDPSA |
Purity/Format | Affinity purified |
Blocking Peptide | SRRD Blocking Peptide |
Description | Rabbit polyclonal SRRD antibody raised against the middle region of SRRD |
Gene | SRRD |
Supplier Page | Shop |