| Name | RBM34 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4948 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | RBM34 antibody was raised using the C terminal of RBM34 corresponding to a region with amino acids SKPKQGLNFTSKTAEGHPKSLFIGEKAVLLKTKKKGQKKSGRPKKQRKQK |
| Purity/Format | Affinity purified |
| Blocking Peptide | RBM34 Blocking Peptide |
| Description | Rabbit polyclonal RBM34 antibody raised against the C terminal of RBM34 |
| Gene | RBM34 |
| Supplier Page | Shop |