| Name | C18ORF32 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4308 |
| Prices | $375.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | C18ORF32 antibody was raised using the middle region of C18Orf32 corresponding to a region with amino acids PLVSPFVSRIWPKKAIQESNDTNKGKVNFKGADMNGLPTKGPTEICDKKK |
| Purity/Format | Affinity purified |
| Blocking Peptide | C18ORF32 Blocking Peptide |
| Description | Rabbit polyclonal C18ORF32 antibody raised against the middle region of C18Orf32 |
| Gene | C18orf32 |
| Supplier Page | Shop |