Name | C18ORF32 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-4308 |
Prices | $375.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | C18ORF32 antibody was raised using the middle region of C18Orf32 corresponding to a region with amino acids PLVSPFVSRIWPKKAIQESNDTNKGKVNFKGADMNGLPTKGPTEICDKKK |
Purity/Format | Affinity purified |
Blocking Peptide | C18ORF32 Blocking Peptide |
Description | Rabbit polyclonal C18ORF32 antibody raised against the middle region of C18Orf32 |
Gene | C18orf32 |
Supplier Page | Shop |