| Name | RPS14 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1391 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog, Drosophila, Zebrafish |
| Antigen | RPS14 antibody was raised using the middle region of RPS14 corresponding to a region with amino acids GNRTKTPGPGAQSALRALARSGMKIGRIEDVTPIPSDSTRRKGGRRGRRL |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | RPS14 Blocking Peptide |
| Description | Rabbit polyclonal RPS14 antibody raised against the middle region of RPS14 |
| Gene | RPS14 |
| Supplier Page | Shop |