Name | RPS14 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-1391 |
Prices | $275.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Dog, Drosophila, Zebrafish |
Antigen | RPS14 antibody was raised using the middle region of RPS14 corresponding to a region with amino acids GNRTKTPGPGAQSALRALARSGMKIGRIEDVTPIPSDSTRRKGGRRGRRL |
Purity/Format | Total IgG Protein A purified |
Blocking Peptide | RPS14 Blocking Peptide |
Description | Rabbit polyclonal RPS14 antibody raised against the middle region of RPS14 |
Gene | RPS14 |
Supplier Page | Shop |