CENPB antibody

Name CENPB antibody
Supplier Fitzgerald
Catalog 70R-5526
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen CENPB antibody was raised using the C terminal of CENPB corresponding to a region with amino acids GGEDSDSDSEEEDDEEEDDEDEDDDDDEEDGDEVPVPSFGEAMAYFAMVK
Purity/Format Affinity purified
Blocking Peptide CENPB Blocking Peptide
Description Rabbit polyclonal CENPB antibody raised against the C terminal of CENPB
Gene CENPB
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.