| Name | TRAPPC6B antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3155 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | TRAPPC6B antibody was raised using the middle region of TRAPPC6B corresponding to a region with amino acids TTVFKKQIDNLRTNHQYLAFTCGLIRGGLSNLGIKSIVTAEVSSMPACKF |
| Purity/Format | Affinity purified |
| Blocking Peptide | TRAPPC6B Blocking Peptide |
| Description | Rabbit polyclonal TRAPPC6B antibody raised against the middle region of TRAPPC6B |
| Gene | TRAPPC6B |
| Supplier Page | Shop |