| Name | C20ORF19 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4436 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | C20ORF19 antibody was raised using the C terminal Of C20Orf19 corresponding to a region with amino acids SRHENKKKPVINLKSNALWDESDDSNSEIEAALRPRNHNTDDSDDFYD |
| Purity/Format | Affinity purified |
| Blocking Peptide | C20ORF19 Blocking Peptide |
| Description | Rabbit polyclonal C20ORF19 antibody raised against the C terminal Of C20Orf19 |
| Gene | KIZ |
| Supplier Page | Shop |