ACCN3 antibody

Name ACCN3 antibody
Supplier Fitzgerald
Catalog 70R-1519
Prices $275.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications IHC WB
Species Reactivities Human
Antigen ACCN3 antibody was raised using the N terminal of ACCN3 corresponding to a region with amino acids VATFLYQVAERVRYYREFHHQTALDERESHRLIFPAVTLCNINPLRRSRL
Purity/Format Total IgG Protein A purified
Blocking Peptide ACCN3 Blocking Peptide
Description Rabbit polyclonal ACCN3 antibody raised against the N terminal of ACCN3
Gene ASIC3
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.