Name | RC3H2 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-2802 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | RC3H2 antibody was raised using the middle region of RC3H2 corresponding to a region with amino acids YSRKGHETPQPQPNSKYKTSMCRDLRQQGGCPRGTNCTFAHSQEELEKYR |
Purity/Format | Affinity purified |
Blocking Peptide | RC3H2 Blocking Peptide |
Description | Rabbit polyclonal RC3H2 antibody raised against the middle region of RC3H2 |
Gene | RC3H2 |
Supplier Page | Shop |