| Name | C9ORF117 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3540 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Rat |
| Antigen | C9ORF117 antibody was raised using the N terminal Of C9Orf117 corresponding to a region with amino acids LAKEMEKDAFEAQLAQVRHEFQETKDQLTTENIILGGKLAALEEFRLQKE |
| Purity/Format | Affinity purified |
| Blocking Peptide | C9ORF117 Blocking Peptide |
| Description | Rabbit polyclonal C9ORF117 antibody raised against the N terminal Of C9Orf117 |
| Gene | C9orf117 |
| Supplier Page | Shop |