| Name | VSIG4 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1905 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | VSIG4 antibody was raised using the N terminal of VSIG4 corresponding to a region with amino acids VPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVS |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | VSIG4 Blocking Peptide |
| Description | Rabbit polyclonal VSIG4 antibody raised against the N terminal of VSIG4 |
| Gene | VSIG4 |
| Supplier Page | Shop |