Name | LINGO4 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-6498 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | LINGO4 antibody was raised using the middle region of LINGO4 corresponding to a region with amino acids TLEIRSVQLRDRGAYVCVVSNVAGNDSLRTWLEVIQVEPPNGTLSDPNIT |
Purity/Format | Affinity purified |
Blocking Peptide | LINGO4 Blocking Peptide |
Description | Rabbit polyclonal LINGO4 antibody raised against the middle region of LINGO4 |
Gene | LINGO4 |
Supplier Page | Shop |