| Name | C4ORF33 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4121 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | C4ORF33 antibody was raised using the C terminal Of C4Orf33 corresponding to a region with amino acids PNVTKFNSFAIHGSKDKRSYEALYPVPQHELQQGQKPDFHCLEYFKSFNF |
| Purity/Format | Affinity purified |
| Blocking Peptide | C4ORF33 Blocking Peptide |
| Description | Rabbit polyclonal C4ORF33 antibody raised against the C terminal Of C4Orf33 |
| Gene | C4orf33 |
| Supplier Page | Shop |