| Name | SEPHS1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1203 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | SEPHS1 antibody was raised using the C terminal of SEPHS1 corresponding to a region with amino acids PKYGEGHQAWIIGIVEKGNRTARIIDKPRIIEVAPQVATQNVNPTPGATS |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | SEPHS1 Blocking Peptide |
| Description | Rabbit polyclonal SEPHS1 antibody raised against the C terminal of SEPHS1 |
| Gene | TBX4 |
| Supplier Page | Shop |