| Name | MYH1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3929 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | MYH1 antibody was raised using the N terminal of MYH1 corresponding to a region with amino acids KTSVFVVDPKESFVKATVQSREGGKVTAKTEAGATVTVKDDQVFPMNPPK |
| Purity/Format | Affinity purified |
| Blocking Peptide | MYH1 Blocking Peptide |
| Description | Rabbit polyclonal MYH1 antibody raised against the N terminal of MYH1 |
| Gene | MYH1 |
| Supplier Page | Shop |