NARF antibody

Name NARF antibody
Supplier Fitzgerald
Catalog 70R-2294
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen NARF antibody was raised using the middle region of NARF corresponding to a region with amino acids FRNIQNMILKLKKGKFPFHFVEVLACAGGCLNGRGQAQTPDGHADKALLR
Purity/Format Affinity purified
Blocking Peptide NARF Blocking Peptide
Description Rabbit polyclonal NARF antibody raised against the middle region of NARF
Gene NARF
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.