| Name | HNRPAB antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4665 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | HNRPAB antibody was raised using the N terminal Of Hnrpab corresponding to a region with amino acids GAAAGAGGATAAPPSGNQNGAEGDQINASKNEEDAGKMFVGGLSWDTSKK |
| Purity/Format | Affinity purified |
| Blocking Peptide | HNRPAB Blocking Peptide |
| Description | Rabbit polyclonal HNRPAB antibody raised against the N terminal Of Hnrpab |
| Gene | HNRNPAB |
| Supplier Page | Shop |