| Name | HADH antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2486 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | HADH antibody was raised using the C terminal of HADH corresponding to a region with amino acids YPMGPFELLDYVGLDTTKFIVDGWHEMDAENPLHQPSPSLNKLVAENKFG |
| Purity/Format | Affinity purified |
| Blocking Peptide | HADH Blocking Peptide |
| Description | Rabbit polyclonal HADH antibody raised against the C terminal of HADH |
| Gene | HADH |
| Supplier Page | Shop |