| Name | EXOC6 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3769 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | EXOC6 antibody was raised using the N terminal of EXOC6 corresponding to a region with amino acids MLEEETDQTYENVLAEIQSFELPVEATLRSVYDDQPNAHKKFMEKLDACI |
| Purity/Format | Affinity purified |
| Blocking Peptide | EXOC6 Blocking Peptide |
| Description | Rabbit polyclonal EXOC6 antibody raised against the N terminal of EXOC6 |
| Gene | EXOC6 |
| Supplier Page | Shop |