| Name | AARS antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4697 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | AARS antibody was raised using the N terminal of AARS corresponding to a region with amino acids DSTLTASEIRQRFIDFFKRNEHTYVHSSATIPLDDPTLLFANAGMNQFKP |
| Purity/Format | Affinity purified |
| Blocking Peptide | AARS Blocking Peptide |
| Description | Rabbit polyclonal AARS antibody raised against the N terminal of AARS |
| Gene | AARS |
| Supplier Page | Shop |