| Name | SLC26A5 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1782 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | SLC26A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids FSVTISMAKTLANKHGYQVDGNQELIALGLCNSIGSLFQTFSISCSLSRS |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | SLC26A5 Blocking Peptide |
| Description | Rabbit polyclonal SLC26A5 antibody |
| Gene | SLC26A5 |
| Supplier Page | Shop |