Name | PAQR6 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-6375 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | PAQR6 antibody was raised using the N terminal of PAQR6 corresponding to a region with amino acids PGLSKVLRTGAFAYPFLFDNLPLFYRLGLCWGRGHGCGQEALSTSHGYHL |
Purity/Format | Affinity purified |
Blocking Peptide | PAQR6 Blocking Peptide |
Description | Rabbit polyclonal PAQR6 antibody raised against the N terminal of PAQR6 |
Gene | PAQR6 |
Supplier Page | Shop |