| Name | RP11-529I10.4 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2999 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | RP11-529I10.4 antibody was raised using the middle region of RP11-529I10.4 corresponding to a region with amino acids APLGAGNLGPELIKESNANPIFMRKDTKMSFQWRIRNLPYPKDVYSVSVD |
| Purity/Format | Affinity purified |
| Blocking Peptide | RP11-529I10.4 Blocking Peptide |
| Description | Rabbit polyclonal RP11-529I10.4 antibody raised against the middle region of RP11-529I10.4 |
| Gene | DPCD |
| Supplier Page | Shop |