| Name | MED31 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4345 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | MED31 antibody was raised using the N terminal of MED31 corresponding to a region with amino acids MAAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVN |
| Purity/Format | Affinity purified |
| Blocking Peptide | MED31 Blocking Peptide |
| Description | Rabbit polyclonal MED31 antibody raised against the N terminal of MED31 |
| Gene | MED31 |
| Supplier Page | Shop |