| Name | UCHL5IP antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3801 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | UCHL5IP antibody was raised using the middle region of UCHL5IP corresponding to a region with amino acids LLDTIRSLTIGCSSCSSLMEHFEDTREKNEALLGELFSSPHLQMLLNPEC |
| Purity/Format | Affinity purified |
| Blocking Peptide | UCHL5IP Blocking Peptide |
| Description | Rabbit polyclonal UCHL5IP antibody raised against the middle region of UCHL5IP |
| Gene | HAUS7 |
| Supplier Page | Shop |