Name | UCHL5IP antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-3801 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | UCHL5IP antibody was raised using the middle region of UCHL5IP corresponding to a region with amino acids LLDTIRSLTIGCSSCSSLMEHFEDTREKNEALLGELFSSPHLQMLLNPEC |
Purity/Format | Affinity purified |
Blocking Peptide | UCHL5IP Blocking Peptide |
Description | Rabbit polyclonal UCHL5IP antibody raised against the middle region of UCHL5IP |
Gene | HAUS7 |
Supplier Page | Shop |