SASP antibody

Name SASP antibody
Supplier Fitzgerald
Catalog 70R-3449
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen SASP antibody was raised using the middle region of Sasp corresponding to a region with amino acids RGEALGVYNRLSPQDQGDYGTVKEALLKAFGVPGAAPSHLPKEIVFANSM
Purity/Format Affinity purified
Blocking Peptide SASP Blocking Peptide
Description Rabbit polyclonal SASP antibody raised against the middle region of Sasp
Gene ASPRV1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.