Chymotrypsinogen B1 antibody

Name Chymotrypsinogen B1 antibody
Supplier Fitzgerald
Catalog 70R-7498
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Dog
Antigen Chymotrypsinogen B1 antibody was raised using the middle region of CTRB1 corresponding to a region with amino acids FKNPKFSILTVNNDITLLKLATPARFSQTVSAVCLPSADDDFPAGTLCAT
Purity/Format Affinity purified
Blocking Peptide Chymotrypsinogen B1 Blocking Peptide
Description Rabbit polyclonal Chymotrypsinogen B1 antibody raised against the middle region of CTRB1
Gene CTRB1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.