| Name | WDR33 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6952 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | WDR33 antibody was raised using the N terminal of WDR33 corresponding to a region with amino acids IWQRDQRDMRAIQPDAGYYNDLVPPIGMLNNPMNAVTTKFVRTSTNKVKC |
| Purity/Format | Affinity purified |
| Blocking Peptide | WDR33 Blocking Peptide |
| Description | Rabbit polyclonal WDR33 antibody raised against the N terminal of WDR33 |
| Gene | WDR33 |
| Supplier Page | Shop |