| Name | DFNA5 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1267 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human |
| Antigen | DFNA5 antibody was raised using the C terminal of DFNA5 corresponding to a region with amino acids AALLGTCCKLQIIPTLCHLLRALSDDGVSDLEDPTLTPLKDTERFGIVQR |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | DFNA5 Blocking Peptide |
| Description | Rabbit polyclonal DFNA5 antibody raised against the C terminal of DFNA5 |
| Gene | DFNA5 |
| Supplier Page | Shop |