Name | ApoBEC3G antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-1653 |
Prices | $275.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | ApoBEC3G antibody was raised using the N terminal of APOBEC3G corresponding to a region with amino acids AKIFRGQVYSELKYHPEMRFFHWFSKWRKLHRDQEYEVTWYISWSPCTKC |
Purity/Format | Total IgG Protein A purified |
Blocking Peptide | ApoBEC3G Blocking Peptide |
Description | Rabbit polyclonal ApoBEC3G antibody raised against the N terminal of APOBEC3G |
Gene | APOBEC3G |
Supplier Page | Shop |