| Name | ApoBEC3G antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1653 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | ApoBEC3G antibody was raised using the N terminal of APOBEC3G corresponding to a region with amino acids AKIFRGQVYSELKYHPEMRFFHWFSKWRKLHRDQEYEVTWYISWSPCTKC |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | ApoBEC3G Blocking Peptide |
| Description | Rabbit polyclonal ApoBEC3G antibody raised against the N terminal of APOBEC3G |
| Gene | APOBEC3G |
| Supplier Page | Shop |