| Name | ECHS1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1107 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | ECHS1 antibody was raised using the C terminal of ECHS1 corresponding to a region with amino acids KESVNAAFEMTLTEGSKLEKKLFYSTFATDDRKEGMTAFVEKRKANFKDQ |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | ECHS1 Blocking Peptide |
| Description | Rabbit polyclonal ECHS1 antibody raised against the C terminal of ECHS1 |
| Gene | ECHS1 |
| Supplier Page | Shop |