NKAIN4 antibody

Name NKAIN4 antibody
Supplier Fitzgerald
Catalog 70R-7530
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen NKAIN4 antibody was raised using the N terminal of NKAIN4 corresponding to a region with amino acids MGSCSGRCALVVLCAFQLVAALERQVFDFLGYQWAPILANFVHIIIVILG
Purity/Format Affinity purified
Blocking Peptide NKAIN4 Blocking Peptide
Description Rabbit polyclonal NKAIN4 antibody raised against the N terminal of NKAIN4
Gene NKAIN4
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.