| Name | MAN1A2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6984 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | MAN1A2 antibody was raised using the middle region of MAN1A2 corresponding to a region with amino acids FALGADGSRADKAGHYLELGAEIARTCHESYDRTALKLGPESFKFDGAVE |
| Purity/Format | Affinity purified |
| Blocking Peptide | MAN1A2 Blocking Peptide |
| Description | Rabbit polyclonal MAN1A2 antibody raised against the middle region of MAN1A2 |
| Gene | MAN1A2 |
| Supplier Page | Shop |