Name | APEH antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-2583 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | APEH antibody was raised using the N terminal of APEH corresponding to a region with amino acids VYEDDCFGCLSWSHSETHLLYVAEKKRPKAESFFQTKALDVSASDDEIAR |
Purity/Format | Affinity purified |
Blocking Peptide | APEH Blocking Peptide |
Description | Rabbit polyclonal APEH antibody raised against the N terminal of APEH |
Gene | APEH |
Supplier Page | Shop |