| Name | LARP7 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4953 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | LARP7 antibody was raised using the C terminal of LARP7 corresponding to a region with amino acids WQKILVDRQAKLNQPREKKRGTEKLITKAEKIRLAKTQQASKHIRFSEYD |
| Purity/Format | Affinity purified |
| Blocking Peptide | LARP7 Blocking Peptide |
| Description | Rabbit polyclonal LARP7 antibody raised against the C terminal of LARP7 |
| Gene | LARP7 |
| Supplier Page | Shop |