Name | DND1 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-4729 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | DND1 antibody was raised using a synthetic peptide corresponding to a region with amino acids HRFWYQVVIPGHPVPFSGLIWVVLTLDGRDGHEVAKDAVSVRLLQALSES |
Purity/Format | Affinity purified |
Blocking Peptide | DND1 Blocking Peptide |
Description | Rabbit polyclonal DND1 antibody |
Gene | DND1 |
Supplier Page | Shop |