ADAD2 antibody

Name ADAD2 antibody
Supplier Fitzgerald
Catalog 70R-4921
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen ADAD2 antibody was raised using the C terminal of ADAD2 corresponding to a region with amino acids TPDTCRGLSLNWSLGDPGIEVVDVATGRVKANAALGPPSRLCKASFLRAF
Purity/Format Affinity purified
Blocking Peptide ADAD2 Blocking Peptide
Description Rabbit polyclonal ADAD2 antibody raised against the C terminal of ADAD2
Gene ADAD2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.