ST3GAL5 antibody

Name ST3GAL5 antibody
Supplier Fitzgerald
Catalog 70R-1878
Prices $275.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications IHC WB
Species Reactivities Human, Mouse, Rat
Antigen ST3GAL5 antibody was raised using the N terminal of ST3GAL5 corresponding to a region with amino acids DSEAESKYDPPFGFRKFSSKVQTLLELLPEHDLPEHLKAKTCRRCVVIGS
Purity/Format Total IgG Protein A purified
Blocking Peptide ST3GAL5 Blocking Peptide
Description Rabbit polyclonal ST3GAL5 antibody raised against the N terminal of ST3GAL5
Gene ST3GAL5
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.