| Name | IDI1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3705 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | IDI1 antibody was raised using the middle region of IDI1 corresponding to a region with amino acids PLSNPAELEESDALGVRRAAQRRLKAELGIPLEEVPPEEINYLTRIHYKA |
| Purity/Format | Affinity purified |
| Blocking Peptide | IDI1 Blocking Peptide |
| Description | Rabbit polyclonal IDI1 antibody raised against the middle region of IDI1 |
| Gene | IDI1 |
| Supplier Page | Shop |