| Name | FAM135B antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3897 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Rat |
| Antigen | FAM135B antibody was raised using the middle region of FAM135B corresponding to a region with amino acids TLVSTGLWLMQKLKKSGSLLQLTFRDNADLRKCFLYQLSQKTGLQYFKNV |
| Purity/Format | Affinity purified |
| Blocking Peptide | FAM135B Blocking Peptide |
| Description | Rabbit polyclonal FAM135B antibody raised against the middle region of FAM135B |
| Gene | FAM135B |
| Supplier Page | Shop |