Name | DHODH antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-6503 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Dog |
Antigen | DHODH antibody was raised using the C terminal of DHODH corresponding to a region with amino acids GGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGAS |
Purity/Format | Affinity purified |
Blocking Peptide | DHODH Blocking Peptide |
Description | Rabbit polyclonal DHODH antibody raised against the C terminal of DHODH |
Gene | DHODH |
Supplier Page | Shop |