| Name | Cyclin J antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3737 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Cyclin J antibody was raised using the N terminal of CCNJ corresponding to a region with amino acids FMDRYDISIQQLHLVALSCLLLASKFEEKEDSVPKLEQLNSLGCMTNMNL |
| Purity/Format | Affinity purified |
| Blocking Peptide | Cyclin J Blocking Peptide |
| Description | Rabbit polyclonal Cyclin J antibody raised against the N terminal of CCNJ |
| Gene | CCNJ |
| Supplier Page | Shop |